SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410613 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410613
Domain Number 1 Region: 524-893
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.58e-128
Family Hect, E3 ligase catalytic domain 0.0000000038
Further Details:      
 
Domain Number 2 Region: 20-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-29
Family Synaptotagmin-like (S variant) 0.075
Further Details:      
 
Domain Number 3 Region: 469-508
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000431
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 182-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000181
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000515
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 421-455
Classification Level Classification E-value
Superfamily WW domain 0.00000000000306
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410613   Gene: ENSG00000069869   Transcript: ENST00000435532
Sequence length 900
Comment pep:known chromosome:GRCh38:15:55826922:55993746:-1 gene:ENSG00000069869 transcript:ENST00000435532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCAVEVFGLLEDEENSRIVRVRVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQ
TKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRL
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQAFPSPPPSSNLDVPTHLAEE
LNARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPF
YKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGS
EIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGL
GDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences NP_006145.2.87134 NP_006145.2.92137 ENSP00000410613 gi|114520609|ref|NP_006145.2| ENSP00000410613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]