SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417003 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417003
Domain Number 1 Region: 276-456
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-24
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 2 Region: 208-308
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000135
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSP00000417003
Domain Number - Region: 510-527,674-725
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00879
Family Di-heme elbow motif 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417003   Gene: ENSG00000178385   Transcript: ENST00000427836
Sequence length 761
Comment pep:known chromosome:GRCh38:2:207828303:208025560:-1 gene:ENSG00000178385 transcript:ENST00000427836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALEVDDISPALEVTEEFFSTLDSNLEKAVQQAEVYGIQEVPELVGHEVLSNITDNGAM
RNVTSLGKGGMIWDHCKSRLLETKAQNVFPAKEQFMVQRGTTPDNLSWMEQKEASTFNFF
NICQRRRDRPRSVNDLLDETSTFKPGHARSRSDITQVDWRVVLKTTPLQQQQQQQPLLQG
PHVTRPSFLLPSPNKIEDAQGNTEHKQTFPNILKKGYLEIRKDHDSYWQSCYAELSPYNL
YFYSLDSSGNQNLYATYQLSHFQSISVLGNLEARMVDTVLYDNTQLQLKAESPWEALDWG
QKLWEVVHAAVPGYMGRQNELTISPGLGHHDDYTQNHSFQKKTSGLLPPSPVLDSSKQYQ
NILKSGTLYRLTVQNNWKAFTFVLSRAYLMAFQPGKLDEDPLLSYNVDVCLAVQMDNLDG
CDSCFQVIFPQDVLRLRAETRQRAQEWMEALKIAANVARSSEQNLQVTLRNKPKDQMGGH
ELRKNKRQSVTTSFLSILTTLSLERGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCS
SCHVDDSFLIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENAMLYHHAEPLAA
VLRLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFL
GKVIKFATSHVYSCSLCSQKGFICEICNNGEILYPFEDISTSRCESCGAVFHSECKEKSV
PCPRCVRRELQKKQKSFWQRLNMDESLEEACTMFELSYQNT
Download sequence
Identical sequences Q6ZWE6
ENSP00000417003 ENSP00000373899 gi|122937347|ref|NP_001073944.1| 9606.ENSP00000386217 ENSP00000417003 NP_001073944.1.87134 NP_001073944.1.92137 XP_011509462.1.92137 NYSGRC-122937347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]