SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417603 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000417603
Domain Number - Region: 78-139
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00866
Family Di-heme elbow motif 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417603   Gene: ENSG00000186501   Transcript: ENST00000478104
Sequence length 154
Comment pep:known chromosome:GRCh38:1:27322285:27335824:1 gene:ENSG00000186501 transcript:ENST00000478104 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKQYQGSGGVAMDVERSRFPYCVVWTPIPVLTWFFPIIGHMGICTSTGVIRDFAGPYFVS
EDNMAFGKPAKYWKLDPAQVYASGPNAWDTAVHDASEEYKHRMHNLCCDNCHSHVALALN
LMRYNNSTNWNMVTLCFFCLLYGKYVRSLPRQRD
Download sequence
Identical sequences H0Y861 H2PYF1
ENSP00000417603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]