SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418751 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418751
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 1.33e-27
Family BTB/POZ domain 0.0069
Further Details:      
 
Domain Number 2 Region: 441-546
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000078
Family Galactose-binding domain 0.08
Further Details:      
 
Domain Number 3 Region: 309-398
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000078
Family Galactose-binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418751   Gene: ENSG00000183826   Transcript: ENST00000481247
Sequence length 612
Comment pep:known chromosome:GRCh38:6:38168451:38639924:-1 gene:ENSG00000183826 transcript:ENST00000481247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDW
VRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGL
IVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYM
IGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVG
THNTANEVFHCVHFECPEQQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSP
GSNSRSPNRQHQ
Download sequence
Identical sequences G3QIM8 K7B4N3 Q96Q07
ENSP00000418751 ENSP00000386121 ENSP00000418751 NP_001092742.1.87134 NP_001092742.1.92137 NP_443125.1.87134 NP_443125.1.92137 XP_009449460.1.37143 XP_009449461.1.37143 XP_011512581.1.92137 XP_018885251.1.27298 ENSP00000328328 9598.ENSPTRP00000030960 9606.ENSP00000386121 gi|151108411|ref|NP_443125.1| gi|151108413|ref|NP_001092742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]