SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420418 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420418
Domain Number 1 Region: 492-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 533-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 138-197
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-17
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 4 Region: 436-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000712
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 6 Region: 339-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000215
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSP00000420418
Domain Number - Region: 50-121
Classification Level Classification E-value
Superfamily Tropomyosin 0.000163
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420418   Gene: ENSG00000197024   Transcript: ENST00000475153
Sequence length 642
Comment pep:known chromosome:GRCh38:7:149147476:149180465:1 gene:ENSG00000197024 transcript:ENST00000475153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEIH
SRRLLHLEGRTGTAEKKLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLL
RNRNFWILRLPPGIKGDIPKVPVAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLI
SMDYAINQPDVLSQIQPEGEHNTEDQAGPEESEIPTDPSEEPGISTSDILSWIKQEEEPQ
VGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKS
QQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGKNLSQDMLLTH
QCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVH
NSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQE
RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFS
CPHCGKSFIRKHHLMKHQRIHTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGGDSDP
SGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL
Download sequence
Identical sequences A0A090N7S8 Q8TD17
NP_733787.1.87134 NP_733787.1.92137 gi|25777704|ref|NP_733787.1| ENSP00000420418 ENSP00000420418 9606.ENSP00000420418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]