SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421645 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000421645
Domain Number - Region: 363-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000596
Family HkH motif-containing C2H2 finger 0.07
Further Details:      
 
Domain Number - Region: 305-330,527-543
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00544
Family Cytochrome c3-like 0.073
Further Details:      
 
Domain Number - Region: 207-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00834
Family Classic zinc finger, C2H2 0.077
Further Details:      
 
Domain Number - Region: 636-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0532
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number - Region: 752-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0992
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421645   Gene: ENSG00000112200   Transcript: ENST00000491832
Sequence length 1041
Comment pep:putative chromosome:GRCh38:6:57090189:57154544:1 gene:ENSG00000112200 transcript:ENST00000491832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSY
TDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEF
IRGHSDTEAARLCVDQWLKMPGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEF
DNGHLLLGHLKRFDHSPCDPTITLHGPFFSSFACVVCYKKFVTQQQYRDHLFDKEATDDG
HNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQSFKLGDNKGIAHPISFPSFA
KKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKSITQVAEKFIL
RGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLLYCHSSEGNKDPSSDLHLLLD
QSKFSSLKRTMSIKESSSLECIAIPKKKMNLKDKSHEGVACVQKEKSVVKTWFCECNQRF
PSEDAVEKHVFSANTMGYKCVVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKEL
TRKDTIMAHVTEFHNGHRYFYEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANS
SPRGKWQCRICEDMFDSQEYVKQHCMSLASHKFHRYSCAHCRKPFHKIETLYRHCQDEHD
NEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEKTETSIKTEDDFPVIETSNQL
TCGCRESYICKVNRKEDYSRCLQIMLDKGKLWFRCSLCSATAQNLTDMNTHIHQVHKEKS
DEEEQQYVIKCGTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHT
ERKLKQAINYSKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFF
GHLPGHLNQGTFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKRKDAADFAICM
HAGRLDEQLPKQIPFTILSGDQGFLELENQFKKTQRPAHILNPHHLEGDMMCALLNSISD
TTKGTQLQSQCKPPKRRRLHC
Download sequence
Identical sequences E9PH99
ENSP00000421645 ENSP00000421645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]