SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422140 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422140
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 81-124
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000248
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422140   Gene: ENSG00000187821   Transcript: ENST00000505610
Sequence length 241
Comment pep:known chromosome:GRCh38:4:185018841:185020804:1 gene:ENSG00000187821 transcript:ENST00000505610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQ
YLRALHSADFPRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAF
LQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPG
AARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPV
L
Download sequence
Identical sequences A0A2J8L872
ENSP00000422140 NP_001287711.1.87134 NP_001287711.1.92137 ENSP00000422140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]