SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424316 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424316
Domain Number 1 Region: 441-695
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 46-288
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-35
Family YWTD domain 0.0000768
Further Details:      
 
Domain Number 3 Region: 359-434,691-742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 314-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000204
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 932-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000516
Family EGF-type module 0.0002
Further Details:      
 
Domain Number 6 Region: 702-739,792-868
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000322
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 864-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000489
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424316   Gene: ENSG00000138798   Transcript: ENST00000509793
Sequence length 1165
Comment pep:known chromosome:GRCh38:4:109912884:110011994:1 gene:ENSG00000138798 transcript:ENST00000509793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCP
RNVSECSHDCVLTSEGPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECD
CFPGYDLQLDEKSCAASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPV
ENKIYFAHTALKWIERANMDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRS
DLNGKRSKIITKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLI
WPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDW
AMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGT
AWCSCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHM
LVAEIMVSDQDDCAPVGCSMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCP
PASSKCINTEGGYVCRCSEGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAG
RLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACN
CVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQKL
LSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAA
DGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKP
HSLLSANPLWQQRALDPPHQMELTQ
Download sequence
Identical sequences ENSP00000424316 ENSP00000424316 NP_001171602.1.87134 NP_001171602.1.92137 gi|296011015|ref|NP_001171602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]