SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428456 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428456
Domain Number 1 Region: 271-347
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.81e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000299
Further Details:      
 
Domain Number 2 Region: 173-252
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.3e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.00031
Further Details:      
 
Domain Number 3 Region: 52-167
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000204
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Domain Number 4 Region: 5-53
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000248
Family Double-stranded RNA-binding domain (dsRBD) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428456   Gene: ENSG00000040341   Transcript: ENST00000522695
Sequence length 538
Comment pep:known chromosome:GRCh38:8:73420369:73738327:-1 gene:ENSG00000040341 transcript:ENST00000522695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPG
SITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTV
GNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDVDDDKDANKSEISLV
FEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQEL
KKLPPLPVVEKPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSER
GMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENK
GWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSSFF
SISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPPCSPVQPSKQLEYLARIQGFQAA
LSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNSAV
Download sequence
Identical sequences E9PH62
NP_001157853.1.87134 NP_001157853.1.92137 ENSP00000428456 ENSP00000428456 gi|256418997|ref|NP_001157853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]