SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429367 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429367
Domain Number 1 Region: 9-208
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000227
Family FCH domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429367   Gene: ENSG00000188343   Transcript: ENST00000518322
Sequence length 289
Comment pep:known chromosome:GRCh38:8:93700507:93731527:1 gene:ENSG00000188343 transcript:ENST00000518322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRRTLENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAA
TETPHLKLGLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTAR
NREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDI
KTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSLYAPDYSSRLDIVRAN
SKSPLQRSLSAKCVSGTGQVSTCRLRKDQQAEDDEDDELDVTEEENFLK
Download sequence
Identical sequences A1XBS5
ENSP00000429367 gi|150170658|ref|NP_660312.2| NP_660312.2.87134 NP_660312.2.92137 9606.ENSP00000391671 ENSP00000429367 ENSP00000391671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]