SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429485 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429485
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.96e-20
Family Nucleoplasmin-like core domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429485   Gene: ENSG00000181163   Transcript: ENST00000521672
Sequence length 111
Comment pep:putative chromosome:GRCh38:5:171387799:171400155:1 gene:ENSG00000181163 transcript:ENST00000521672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAE
SEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDED
Download sequence
Identical sequences A0A2J8LXV9 E5RI98
ENSP00000429485 ENSP00000429485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]