SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429996 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429996
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 5.49e-26
Family BTB/POZ domain 0.0000341
Further Details:      
 
Weak hits

Sequence:  ENSP00000429996
Domain Number - Region: 82-102
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0188
Family Skp1 dimerisation domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429996   Gene: ENSG00000113558   Transcript: ENST00000520417
Sequence length 102
Comment pep:known chromosome:GRCh38:5:134160996:134174765:-1 gene:ENSG00000113558 transcript:ENST00000520417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFE
Download sequence
Identical sequences E5RGM3
ENSP00000429996 ENSP00000429996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]