SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430336 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430336
Domain Number 1 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 2 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000728
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 3 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family Laminin-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430336   Gene: ENSG00000112769   Transcript: ENST00000521398
Sequence length 331
Comment pep:known chromosome:GRCh38:6:112185319:112254485:-1 gene:ENSG00000112769 transcript:ENST00000521398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQ
Download sequence
Identical sequences E5RFQ2
ENSP00000463061 ENSP00000430336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]