SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432054 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432054
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-43
Family Calponin-homology domain, CH-domain 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432054   Gene: ENSG00000149591   Transcript: ENST00000525531
Sequence length 201
Comment pep:putative chromosome:GRCh38:11:117199382:117204541:1 gene:ENSG00000149591 transcript:ENST00000525531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEG
KDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences A0A2I2YBG4 A0A2K6GVG6 G1R6Y3 H2NFE5 H2Q4U6 Q01995 Q5U0D2
ENSPTRP00000007410 ENSP00000278968 NP_001001522.1.87134 NP_001001522.1.92137 NP_003177.2.87134 NP_003177.2.92137 XP_003253239.1.23891 XP_003253241.1.23891 XP_003253242.1.23891 XP_003313366.1.37143 XP_004052236.1.27298 XP_004090597.1.23891 XP_008971763.1.60992 XP_009245379.1.23681 XP_012351321.1.23891 XP_012351322.1.23891 XP_012513792.1.63892 ENSNLEP00000008955 ENSNLEP00000008955 9598.ENSPTRP00000007410 9600.ENSPPYP00000004479 9606.ENSP00000278968 ENSP00000278968 ENSP00000376678 ENSP00000431941 ENSP00000432054 ENSP00000432282 gi|48255905|ref|NP_003177.2| gi|48255907|ref|NP_001001522.1| ENSPPYP00000004479 ENSPPYP00000004479 ENSP00000278968 ENSP00000376678 ENSP00000431941 ENSP00000432054 ENSP00000432282 ENSPTRP00000007410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]