SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433041 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433041
Domain Number 1 Region: 59-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433041   Gene: ENSG00000158773   Transcript: ENST00000528768
Sequence length 165
Comment pep:putative chromosome:GRCh38:1:161039940:161041721:-1 gene:ENSG00000158773 transcript:ENST00000528768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPR
TTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQVGFYPKLVIISRSFG
RVTTACLKNCRDLTNCSWTMTCFDNRWKILKTRICCFELSCGTTD
Download sequence
Identical sequences H0YD59
ENSP00000433041 ENSP00000433041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]