SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433617 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433617
Domain Number 1 Region: 617-679,711-861
Classification Level Classification E-value
Superfamily RNI-like 4.58e-33
Family 28-residue LRR 0.001
Further Details:      
 
Domain Number 2 Region: 17-101
Classification Level Classification E-value
Superfamily DEATH domain 9.53e-20
Family Pyrin domain, PYD 0.004
Further Details:      
 
Domain Number 3 Region: 191-368
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000186
Family Extended AAA-ATPase domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433617   Gene: ENSG00000174885   Transcript: ENST00000534750
Sequence length 891
Comment pep:known chromosome:GRCh38:11:278365:285359:1 gene:ENSG00000174885 transcript:ENST00000534750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERAD
AVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSGTLLSVSEYKK
KYREHVLQLHARVKERNARSVKITKRFTKLLIAPESAAPEEAMGPAEEPEPGRARRSDTH
TFNRLFRRDEEGRRPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYQGQVDFAFFMPCGEL
LERPGTRSLADLILDQCPDRGAPVPQMLAQPQRLLFILDGADELPALGGPEAAPCTDPFE
AASGARVLGGLLSKALLPTALLLVTTRAAAPGRLQGRLCSPQCAEVRGFSDKDKKKYFYK
YFRDERRAERAYRFVKENETLFALCFVPFVCWIVCTVLRQQLELGRDLSRTSKTTTSVYL
LFITSVLSSAPVADGPRLQGDLRNLCRLAREGVLGRRAQFAEKELEQLELRGSKVQTLFL
SKKELPGVLETEVTYQFIDQSFQEFLAALSYLLEDGGVPRTAAGGVGTLLRGDAQPHSHL
VLTTRFLFGLLSAERMRDIERHFGCMVSERVKQEALRWVQGQGQGCPGVAPEVTEGAKGL
EDTEEPEEEEEGEEPNYPLELLYCLYETQEDAFVRQALCRFPELALQRVRFCRMDVAVLS
YCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGGGSSQGTTKQLPASLLHPLFQ
AMTDPLCHLSSLTLSHCKLPDAVCRDLSEALRAAPALTELGLLHNRLSEAGLRMLSEGLA
WPQCRVQTVRVQLPDPQRGLQYLVGMLRQSPALTTLDLSGCQLPAPMVTYLCAVLQHQGC
GLQTLSLASVELSEQSLQELQAVKRAKPDLVITHPALDGHPQPPKELISTF
Download sequence
Identical sequences ENSP00000433617 NP_001263629.1.87134 NP_001263629.1.92137 ENSP00000433617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]