SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434306 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000434306
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00209
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434306   Gene: ENSG00000163479   Transcript: ENST00000480567
Sequence length 183
Comment pep:known chromosome:GRCh38:1:156009360:156020889:-1 gene:ENSG00000163479 transcript:ENST00000480567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKT
KKN
Download sequence
Identical sequences A0A2I3HPW5 A0A2J8K514 A0A2J8VGN8 P43308
ENSNLEP00000014951 ENSP00000295702 ENSP00000434306 ENSP00000295702 ENSP00000434306 ENSP00000295702 NP_003136.1.87134 NP_003136.1.92137 XP_004089904.1.23891 XP_004089905.1.23891 ENSPTRP00000002439 HR181 ENSPTRP00000002439 9606.ENSP00000295702 ENSNLEP00000014951 gi|4507239|ref|NP_003136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]