SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434546 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434546
Domain Number 1 Region: 97-154
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-16
Family SSRP1-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434546   Gene: ENSG00000149136   Transcript: ENST00000529002
Sequence length 154
Comment pep:putative chromosome:GRCh38:11:57332639:57335873:-1 gene:ENSG00000149136 transcript:ENST00000529002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAE
VSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIR
IYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQR
Download sequence
Identical sequences ENSP00000434546 ENSP00000434546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]