SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435450 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435450
Domain Number 1 Region: 57-92
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 0.0000115
Family MOSC N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435450   Gene: ENSG00000117791   Transcript: ENST00000469583
Sequence length 94
Comment pep:known chromosome:GRCh38:1:220748225:220755060:1 gene:ENSG00000117791 transcript:ENST00000469583 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKL
WIYPVKSCKGVPVSEAECTAMGLRSGNLRDRMCA
Download sequence
Identical sequences A0A2J8QV05 F6V6Z1
ENSP00000435450 ENSP00000435450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]