SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436291 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436291
Domain Number 1 Region: 293-623
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.98e-54
Family Diacylglycerol kinase-like 0.0085
Further Details:      
 
Domain Number 2 Region: 795-916
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-18
Family Ankyrin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSP00000436291
Domain Number - Region: 95-146
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00349
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436291   Gene: ENSG00000149091   Transcript: ENST00000527911
Sequence length 934
Comment pep:known chromosome:GRCh38:11:46347463:46380282:1 gene:ENSG00000149091 transcript:ENST00000527911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRDGSPEARSSDSESASASSSGSERDAGPEPDKAPRRLNKRRFPGLRLFGHRKAITKS
GLQHLAPPPPTPGAPCSESERQIRSTVDWSESATYGEHIWFETNVSGDFCYVGEQYCVAR
MLQKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPTFVRHHWVHRRR
QDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHAAVV
IPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPLLVF
VNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGW
ILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRW
DLHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFR
NKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIPRYCAGTMP
WGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIPVQV
DGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEAL
HYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLD
ATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTP
RSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVV
RYLLDHAPPEILDAVEENPCSPSGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTP
RQRAEKAQDTELAAYLENRQHYQMIQREDQETAV
Download sequence
Identical sequences ENSP00000436291 NP_001186195.1.87134 NP_001186195.1.92137 gi|313102995|ref|NP_001186195.1| ENSP00000436291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]