SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437974 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000437974
Domain Number - Region: 2-46,175-256
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0002
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number - Region: 38-112
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00199
Family Integrin alpha N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437974   Gene: ENSG00000084444   Transcript: ENST00000537625
Sequence length 324
Comment pep:putative chromosome:GRCh38:12:13061715:13142521:1 gene:ENSG00000084444 transcript:ENST00000537625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTGTHKMLSAFNATSGKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQ
PDLCFLLVSGRTGNPVGRPVKYNIVGVGNLIGPQVYITTNGAVYILFGFGNIQAVALRDI
FVQAQNRDSSPPSLQIEEPEWEKRRSINLSELIDVYSDGVELLQMVKAPDSNCSNLLITT
RQSLVLLRGQNLTPYWALRLQGLRSQPTPGYFTDDQTLDFLLQIQDGVGMKKMMVVDGDS
GSIVWSYRAPCHMKETPATSAVTSDQKSVFLFWAEGLSAASPNSDIILGTEPPSLHHLYL
LHPAFPSILLDLANTTGTVTASEG
Download sequence
Identical sequences Q69YM1
ENSP00000437974 ENSP00000437974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]