SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000443935 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443935
Domain Number 1 Region: 57-123
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443935   Gene: ENSG00000059728   Transcript: ENST00000540449
Sequence length 211
Comment pep:known chromosome:GRCh38:2:69915041:69942938:1 gene:ENSG00000059728 transcript:ENST00000540449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRRA
HLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLK
RQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERG
SMQSLGSDEGYSSTSIKRIKLQDSHKACLGL
Download sequence
Identical sequences A0A2I2YPM8 A0A2I3TGR2
NP_001189443.1.87134 NP_001189443.1.92137 XP_003309130.1.37143 ENSP00000443935 gi|321400053|ref|NP_001189443.1| ENSP00000443935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]