SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000444559 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444559
Domain Number 1 Region: 64-287
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000124
Further Details:      
 
Domain Number 2 Region: 355-468
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.13e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000043
Further Details:      
 
Domain Number 3 Region: 295-347
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000235
Family N-terminal domain of adrenodoxin reductase-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444559   Gene: ENSG00000104687   Transcript: ENST00000541648
Sequence length 469
Comment pep:known chromosome:GRCh38:8:30679520:30727835:-1 gene:ENSG00000104687 transcript:ENST00000541648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQGIQTDD
KGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPT
VVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEK
VVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences ENSP00000444559 ENSP00000444559 gi|305410791|ref|NP_001182032.1| NP_001182032.1.87134 NP_001182032.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]