SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445034 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445034
Domain Number 1 Region: 261-319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 114-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 77-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000005
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445034   Gene: ENSG00000101955   Transcript: ENST00000538295
Sequence length 379
Comment pep:known chromosome:GRCh38:X:38149336:38220924:-1 gene:ENSG00000101955 transcript:ENST00000538295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPI
KVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRC
PTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPP
RIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYT
VYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSP
ARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLG
MLQAVAANPTLLLQYGASG
Download sequence
Identical sequences A0A2I2YK62 A0A2I3SF14
ENSP00000445034 gi|282721079|ref|NP_001164223.1| NP_001164223.1.87134 NP_001164223.1.92137 XP_016799389.1.37143 ENSP00000445034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]