SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445135 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445135
Domain Number 1 Region: 604-1042
Classification Level Classification E-value
Superfamily RNI-like 1.57e-75
Family 28-residue LRR 0.0000195
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 9.65e-23
Family Pyrin domain, PYD 0.027
Further Details:      
 
Domain Number 3 Region: 206-293,320-379
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000395
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445135   Gene: ENSG00000022556   Transcript: ENST00000543010
Sequence length 1062
Comment pep:known chromosome:GRCh38:19:54965252:55001142:1 gene:ENSG00000022556 transcript:ENST00000543010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILT
THCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDV
DEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSK
EVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFK
YAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGAL
IEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFL
EEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVP
TCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDL
RLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLS
GVERLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVT
DLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKE
NLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILC
EQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRH
PECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKC
FLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQ
TLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLW
LWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKI
DDFNDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI
Download sequence
Identical sequences Q9NX02
ENSP00000375601 ENSP00000458701 ENSP00000458740 ENSP00000459053 ENSP00000459160 ENSP00000459166 ENSP00000459212 ENSP00000459395 ENSP00000409370 ENSP00000445135 ENSP00000458217 ENSP00000458345 ENSP00000458572 ENSP00000459053 ENSP00000459160 ENSP00000459166 ENSP00000459395 ENSP00000459670 ENSP00000459970 ENSP00000460381 ENSP00000460916 ENSP00000461004 ENSP00000461005 ENSP00000461312 ENSP00000473972 ENSP00000474730 ENSP00000409370 ENSP00000445135 ENSP00000478265 ENSP00000478450 ENSP00000478774 ENSP00000478876 ENSP00000479109 ENSP00000479220 ENSP00000479352 ENSP00000479713 ENSP00000479783 ENSP00000481851 ENSP00000482253 ENSP00000482889 ENSP00000483281 ENSP00000483528 ENSP00000483963 ENSP00000484354 9606.ENSP00000263437 NP_001167552.1.87134 NP_001167552.1.92137 NP_060322.1.87134 NP_060322.1.92137 gi|291463275|ref|NP_001167552.1| gi|8923473|ref|NP_060322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]