SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445137 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445137
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily DNA clamp 2.13e-17
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445137   Gene: ENSG00000172613   Transcript: ENST00000542139
Sequence length 118
Comment pep:known chromosome:GRCh38:11:67391976:67395807:1 gene:ENSG00000172613 transcript:ENST00000542139 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGL
Download sequence
Identical sequences A0A2J8QB38 A0A2J8U0A9 F5H492
ENSP00000445137 ENSP00000445137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]