SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000446972 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000446972
Domain Number 1 Region: 57-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 454-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.66e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000705
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 5 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000229
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSP00000446972
Domain Number - Region: 264-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0828
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000446972   Gene: ENSG00000166704   Transcript: ENST00000551380
Sequence length 508
Comment pep:known chromosome:GRCh38:19:57979154:58002827:-1 gene:ENSG00000166704 transcript:ENST00000551380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGALTDQSWGMTAVDPWASWALCPQYPAWHVEGSLEEGRRATGLPAAQVQE
PVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEP
WSVEQACPQRTCPEWVRNLESKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCK
DQLEMYHMNQSTAMRQMVFMQKQVLSQRSSEFCGLGAEFSQNLNFVPSQRVSQIEHFYKP
DTHAQSWRCDSAIMYADKVTCENNDYDKTVYQSIQPIYPARIQTGDNLFKCTDAVKSFNH
IIHFGDHKGIHTGEKLYEYKECHQIFNQSPSFNEHPRLHVGENQYNYKEYENIFYFSSFM
EHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYDYNECGTSFIWSSYLIQHKK
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLIGHQRTHTG
Download sequence
Identical sequences F8W1C8
ENSP00000446972 ENSP00000446972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]