SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000448843 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000448843
Domain Number - Region: 23-102
Classification Level Classification E-value
Superfamily GAF domain-like 0.0628
Family GAF domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448843   Gene: ENSG00000185920   Transcript: ENST00000546820
Sequence length 174
Comment pep:known chromosome:GRCh38:9:95480061:95508040:-1 gene:ENSG00000185920 transcript:ENST00000546820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELIT
ETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKI
NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNG
Download sequence
Identical sequences A0A0C4DGI4 A0A2J8JHA8
ENSP00000447008 ENSP00000447797 ENSP00000447878 ENSP00000448843 ENSP00000447008 ENSP00000447797 ENSP00000447878 ENSP00000448843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]