SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000449974 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449974
Domain Number 1 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 90-152
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000685
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 286-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000737
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449974   Gene: ENSG00000167528   Transcript: ENST00000547026
Sequence length 424
Comment pep:known chromosome:GRCh38:12:48342556:48350891:-1 gene:ENSG00000167528 transcript:ENST00000547026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQSLQE
KAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFY
GEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGDGSEHE
GDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPSSSRGMLLGPPFLQEDSFSNLLCS
TEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKTFGRRHHLIRHQKTH
LHDKTSRCSECGKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGTRKRQRAPPVPKCHVC
TECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRG
TSVF
Download sequence
Identical sequences ENSP00000449974 NP_001166152.1.87134 NP_001166152.1.92137 XP_005268695.1.92137 XP_011536200.1.92137 ENSP00000449974 gi|289547733|ref|NP_001166152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]