SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450927 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450927
Domain Number 1 Region: 24-56
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000602
Family GABA-aminotransferase-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450927   Gene: ENSG00000182199   Transcript: ENST00000557348
Sequence length 65
Comment pep:known chromosome:GRCh38:12:57230103:57234476:1 gene:ENSG00000182199 transcript:ENST00000557348 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASEILWG
SRGGG
Download sequence
Identical sequences A0A2J8KWC8 A0A2J8UHB2 G3V2Y1
ENSP00000450927 ENSP00000451872 ENSP00000452339 ENSP00000450927 ENSP00000451872 ENSP00000452339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]