SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000451012 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451012
Domain Number 1 Region: 55-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000484
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 2 Region: 112-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 3 Region: 18-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 4 Region: 150-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451012   Gene: ENSG00000123384   Transcript: ENST00000555124
Sequence length 183
Comment pep:putative chromosome:GRCh38:12:57201108:57203276:1 gene:ENSG00000123384 transcript:ENST00000555124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMT
CGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECGEPRPHSRRKTVYLDERTCEPY
QFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHD
CAD
Download sequence
Identical sequences H0YJ88
ENSP00000451012 ENSP00000451012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]