SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452404 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452404
Domain Number 1 Region: 20-215
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.33e-80
Family GABA-aminotransferase-like 0.00000000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452404   Gene: ENSG00000182199   Transcript: ENST00000554975
Sequence length 215
Comment pep:putative chromosome:GRCh38:12:57230360:57232568:1 gene:ENSG00000182199 transcript:ENST00000554975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
RAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
SGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKT
GLIDYNQLALTARLFRPRLIIAGTSAYARLIDYAR
Download sequence
Identical sequences G3V5L0
ENSP00000452404 ENSP00000452404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]