SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000456281 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456281
Domain Number 1 Region: 229-387
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.97e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000249
Further Details:      
 
Domain Number 2 Region: 68-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000673
Further Details:      
 
Domain Number 3 Region: 25-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000135
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456281   Gene: ENSG00000140545   Transcript: ENST00000566497
Sequence length 387
Comment pep:novel chromosome:GRCh38:15:88898715:88913381:-1 gene:ENSG00000140545 transcript:ENST00000566497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKG
YAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPS
SNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHK
EFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNS
IPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVT
GIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFET
PILARYVRILPVAWHNRIALRLELLGC
Download sequence
Identical sequences ENSP00000268150 ENSP00000456281 9606.ENSP00000268150 ENSP00000268150 NP_005919.2.87134 NP_005919.2.92137 ENSP00000268150 ENSP00000456281 gi|167830475|ref|NP_005919.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]