SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000456662 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456662
Domain Number 1 Region: 67-110
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000799
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456662   Gene: ENSG00000138629   Transcript: ENST00000565494
Sequence length 114
Comment pep:novel chromosome:GRCh38:15:74445977:74449311:-1 gene:ENSG00000138629 transcript:ENST00000565494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQSGTPITNDLFSQALQHAL
QASGQPSLQSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP
Download sequence
Identical sequences A0A2J8KRR4 A0A2J8UD60 F7EMI6 H3BSE0
ENSP00000456662 ENSP00000456662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]