SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457183 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457183
Domain Number 1 Region: 37-215
Classification Level Classification E-value
Superfamily PR-1-like 2.22e-54
Family PR-1-like 0.00011
Further Details:      
 
Domain Number 2 Region: 283-381
Classification Level Classification E-value
Superfamily LCCL domain 1.83e-29
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 3 Region: 385-490
Classification Level Classification E-value
Superfamily LCCL domain 5.23e-28
Family LCCL domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457183   Gene: ENSG00000103196   Transcript: ENST00000567845
Sequence length 496
Comment pep:novel chromosome:GRCh38:16:84819991:84907112:1 gene:ENSG00000103196 transcript:ENST00000567845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEIL
MLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGR
YRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTC
RKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYRETYT
PKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGS
TCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDITRNGKVPFFVK
SERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEP
SYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSESL
GTPRDGKAFRIFAVRQ
Download sequence
Identical sequences H3BTI0
ENSP00000457183 ENSP00000457183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]