SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457616 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457616
Domain Number 1 Region: 228-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.63e-26
Family DnaQ-like 3'-5' exonuclease 0.001
Further Details:      
 
Domain Number 2 Region: 505-664
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.78e-16
Family Canonical RBD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457616   Gene: ENSG00000005189   Transcript: ENST00000564274
Sequence length 774
Comment pep:known chromosome:GRCh38:16:20806698:20849480:1 gene:ENSG00000005189 transcript:ENST00000564274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEREGTERHPRKVRESRQAPNKLVGAAEAMKAGWDLEESQPEAKKARLSTILFTDNCE
VTHDQLCELLKYAVLGKSNVPKPSWCQLFHQNHLNNVVVFVLQGMSQLHFYRFYLEFGCL
RKAFRHKFRLPPPSSDFLADVVGLQTEQRAGDLPKTMEGPLPSNAKAAINLQDDPIIQKY
GSKKVGLTRCLLTKEEMRTFHFPLQGFPDCENFLLTKCNGSIADNSPLFGLDCEMCLTSK
GRELTRISLVAEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL
LPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLAKVILGKDIQCPDR
LGHDATEDARTILELARYFLKHGPKKIAELNLEALANHQEIQAAGQEPKNTAEVLQHPNT
SVLECLDSVGQKLLFLTRETDAGELPSSRNCQTIKCLSNKEVLEQARVEIPLFPFSIVQF
SFKAFSPVLTEEMNKRMRIKWTEISTVYAGPFSKNCNLRALKRLFKSFGPVQSMTFVLET
RQPHLCIQYEVLEAAQLAIESLDGILVDGICIKVQRPVTELTLDCDTLVNELEGDSENQG
SIYLSGVSETFKEQLLQEPRLFLGLEAVILPKDLKSGKQKKYCFLKFKSFGSAQQALNIL
TGKDWKLKGRHALTPRHLHAWLRGLPPESTRLPGLRVVPPPFEQEALQTLKLDHPKIAAW
RWSRKIGKLYNSLCPGTLCLILLPGTKSTHGSLSGLGLMGIKEEEESAGPGLCS
Download sequence
Identical sequences A0A024R390 Q96IC2
NP_001185982.1.87134 NP_001185982.1.92137 NP_112203.2.87134 NP_112203.2.92137 XP_005255661.1.92137 XP_011544265.1.92137 ENSP00000261377 ENSP00000457616 9606.ENSP00000261377 gi|222136613|ref|NP_112203.2| gi|312261259|ref|NP_001185982.1| ENSP00000261377 ENSP00000261377 ENSP00000457616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]