SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457655 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457655
Domain Number 1 Region: 36-215
Classification Level Classification E-value
Superfamily PR-1-like 1.83e-54
Family PR-1-like 0.00011
Further Details:      
 
Domain Number 2 Region: 284-382
Classification Level Classification E-value
Superfamily LCCL domain 1.57e-29
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 3 Region: 386-438
Classification Level Classification E-value
Superfamily LCCL domain 0.00000105
Family LCCL domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457655   Gene: ENSG00000103196   Transcript: ENST00000564567
Sequence length 449
Comment pep:known chromosome:GRCh38:16:84820003:84880725:1 gene:ENSG00000103196 transcript:ENST00000564567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEIL
MLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGR
YRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTC
RKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETY
TPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKG
STCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDITRNGKVPFFV
KSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE
PSYWAPVFGTNIYADVSRMHFQQLSRKAC
Download sequence
Identical sequences ENSP00000457655 ENSP00000457655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]