SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459016 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459016
Domain Number 1 Region: 324-401
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.69e-19
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Domain Number 2 Region: 94-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000146
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  ENSP00000459016
Domain Number - Region: 215-322
Classification Level Classification E-value
Superfamily Prefoldin 0.00112
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459016   Gene: ENSG00000262164   Transcript: ENST00000575391
Sequence length 491
Comment pep:known chromosome:GRCh38:CHR_HSCHR17_4_CTG4:40958544:40967019:-1 gene:ENSG00000262164 transcript:ENST00000575391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKGCTTTNSPSTPCQNCSRITNVSTISSNNGCHPGGLTVNNCQPAGHVLRIPWDQGCQ
PTPRFCRKPIYLMNNFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERE
NAELESKIQEESNKELPVLCPDYLSYYTTIEELQQKILCTKAENSRLVSQIDNTKLTADD
LRAKYEAEVSLRQLVESDANGLKQILNVLTLGKADLEAQVQSLKEELLCLKNNHKEEINS
LQCQLGERLDIEVTAAPSADLNQVLQEMRCQYEPIMETNRKDVEQWFNTQIEELNQQVVT
SSQQQQCCQKEIIELRRSVNTLEVELQAQHRMRDSQECILTETEARYTALLTQIQSLIDN
LEAQLAEIRCALERQNQEYEILLDVKSRLECEITTYRSLLESSDGKRPCYPRATKCEPSP
WTSCKSGAIESTAPACTSSSPCSLKEHCSACGPLSRILVKICTITKEIKDGKVISSYEHV
QPCFIIRPAKV
Download sequence
Identical sequences Q6A163
NYSGRC-148277620 NP_998821.3.87134 NP_998821.3.92137 gi|148277620|ref|NP_998821.3| 9606.ENSP00000347823 ENSP00000347823 ENSP00000459016 ENSP00000347823 ENSP00000459016 ENSP00000347823 ENSP00000459016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]