SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461043 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461043
Domain Number 1 Region: 347-537
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-65
Family Sec7 domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 545-677
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000477
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461043   Gene: ENSG00000262607   Transcript: ENST00000571363
Sequence length 759
Comment pep:known chromosome:GRCh38:CHR_HSCHR12_1_CTG1:81391:175345:1 gene:ENSG00000262607 transcript:ENST00000571363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRSPTAES
LAAEKALMEGYGLVGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALSTWSLK
TMCSLRESGAYQLHQALQAAAGPPGLEAEGRAPESAGPGPGDDAAETPGLPPAHSGTLMM
AFRDVTVQIANQNISVSSSTALSVANCLGAQTVQAPAEPAAGKAEQGETSGREAPEAPAV
GREDASAEDSCAEAAASGAADGATAPKTEEEEEEEETAEVGRGAEAEAGDLEQLSSSSTS
TKSAKSGSEASASASKDALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLNLFN
INPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDE
MDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIFILA
FAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNE
DHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLV
ILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFCALG
SDEMQKFVEDLKESIAEVTELEQIRIEWELEKQQGTKTLSFKPCGAQGDPQSKQGSPTAK
REAALRERPAESTVEVLINASPARLTILPISRDTIKSYC
Download sequence
Identical sequences ENSP00000372292 ENSP00000461043 NP_056047.1.87134 NP_056047.1.92137 gi|71143127|ref|NP_056047.1| ENSP00000372292 ENSP00000456630 ENSP00000461043 9606.ENSP00000372292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]