SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462330 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462330
Domain Number 1 Region: 39-60
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000153
Family N-terminal domain of adrenodoxin reductase-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462330   Gene: ENSG00000161513   Transcript: ENST00000580492
Sequence length 91
Comment pep:known chromosome:GRCh38:17:74866131:74872968:-1 gene:ENSG00000161513 transcript:ENST00000580492 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKL
PPCSPAAPPGPRGHLRETACALWPGALWCGA
Download sequence
Identical sequences J3KS64
ENSP00000462330 ENSP00000462330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]