SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000467111 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467111
Domain Number 1 Region: 11-174
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.01e-44
Family Isochorismatase-like hydrolases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467111   Gene: ENSG00000063241   Transcript: ENST00000589080
Sequence length 175
Comment pep:known chromosome:GRCh38:19:55455002:55461626:-1 gene:ENSG00000063241 transcript:ENST00000589080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPSLGRVLPGSSVLFLCDMQEKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQ
YPQGLGPTVPELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTL
DLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHP
Download sequence
Identical sequences ENSP00000467111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]