SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000468032 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468032
Domain Number 1 Region: 116-402
Classification Level Classification E-value
Superfamily ARM repeat 4.22e-30
Family Armadillo repeat 0.049
Further Details:      
 
Domain Number 2 Region: 400-482
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-18
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 558-679
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000275
Family Toll/Interleukin receptor TIR domain 0.0066
Further Details:      
 
Domain Number 4 Region: 483-545
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000182
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468032   Gene: ENSG00000004139   Transcript: ENST00000585482
Sequence length 724
Comment pep:known chromosome:GRCh38:17:28371662:28404049:1 gene:ENSG00000004139 transcript:ENST00000585482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTLLLSAYKLCRFFAMSGPRPGAERLAVPGPDGGGGTGPWWAAGGRGPREVSPGAGTE
VQDALERALPELQQALSALKQAGGARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAI
RLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVEL
ARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQA
VQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLALVEPLV
ASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQG
KTKVFSDIGAIQSLKRLVSYSTNGTKSALAKRALRLLGEEVPRPILPSVPSWKEAEVQTW
LQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYS
TCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILT
AAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEA
GKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGF
EWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAP
MGPT
Download sequence
Identical sequences G3R687 K7AVX3 Q6SZW1
gi|154090976|ref|NP_055892.2| NYSGRC-154090976 ENSGGOP00000024858 ENSGGOP00000010830 NP_055892.2.87134 NP_055892.2.92137 XP_003315585.1.37143 XP_003812708.1.60992 XP_004042097.1.27298 ENSP00000468032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]