SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470684 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470684
Domain Number 1 Region: 52-130
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000165
Family Cyclin A/CDK2-associated p19, Skp2 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470684   Gene: ENSG00000105341   Transcript: ENST00000594660
Sequence length 150
Comment pep:putative chromosome:GRCh38:19:41431749:41436439:-1 gene:ENSG00000105341 transcript:ENST00000594660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLD
NLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLR
RLDISDLPAVSNPGLTQILVEEMLPNCEGP
Download sequence
Identical sequences M0QZP7
ENSP00000470684 ENSP00000470684 ENSP00000476991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]