SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470725 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470725
Domain Number 1 Region: 119-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 2 Region: 163-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000296
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 67-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000470725
Domain Number - Region: 467-762
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00476
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470725   Gene: ENSG00000127507   Transcript: ENST00000594294
Sequence length 774
Comment pep:putative chromosome:GRCh38:19:14736236:14776756:-1 gene:ENSG00000127507 transcript:ENST00000594294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITT
PMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDV
DECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVDECSSGQHQCDSSTVC
FNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLG
RDYKPGLANNTIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLS
NGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPG
MGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTF
SHRSVIPRQKVLCVFWEHGQNGCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDV
QEEDPVLTVITYMGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLVA
IDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALYLFLTARNLTVVNYSSINRFMKKLMFP
VGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWI
LKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSL
QGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN
Download sequence
Identical sequences ENSP00000470725 ENSP00000263380 ENSP00000470725 gi|23397683|ref|NP_690880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]