SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000476312 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000476312
Domain Number 1 Region: 75-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476312   Gene: ENSG00000180535   Transcript: ENST00000609256
Sequence length 189
Comment pep:known chromosome:GRCh38:7:98211427:98212979:1 gene:ENSG00000180535 transcript:ENST00000609256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRR
PGPSGPGGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA
KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYST
QIHSFREGT
Download sequence
Identical sequences Q7RTS1
gi|29126247|ref|NP_803238.1| NP_803238.1.87134 NP_803238.1.92137 ENSP00000326391 ENSP00000326391 ENSP00000476312 ENSP00000326391 ENSP00000476312 9606.ENSP00000326391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]