SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477706 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477706
Domain Number 1 Region: 152-214
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 840-896
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 727-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 881-933
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 784-840
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 690-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000122
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 346-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000179
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477706   Gene: ENSG00000205903   Transcript: ENST00000382252
Sequence length 1004
Comment pep:known chromosome:GRCh38:7:6637322:6656432:1 gene:ENSG00000205903 transcript:ENST00000382252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALHTTPDSPAAQLERAEDGSECDPDQEEEEEEEEKGEEVQEVEEEEEEIVVEEEEEGV
AEVVQDAQVEAVAEVEVEADVEEEDVKEVLAEEECPALGTQERLSRGGDAKSPVLQEKGL
QASRAPATPRDEDLEEEEEEEEDEDEDDLLTAGCQELVTFEDVAVYFSLEEWERLEADQR
GLYQEVMQENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFW
TDDIEDHEEEDDEDFLAEVAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGPD
PGGLGVLADGSEAKPFLPGREPGANLLSPWAFPAAVAPPAGRPETTCDVCGKVFPHRSRL
AKHQRYHAAVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHR
RIHTGERPYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCSHCGRSFSQSSALARHQAVHT
ADRPHCCPDCGQAFRLRADFQRHRRGGGCAEAGGDGPRREPGETAAAAGPEDTDPGPEGS
EVGEADGEAEAAAEEREEAAVAAPTPSGKVDPAPERRFLELGNGLGEGEGPSSHPLGFHF
PVHPKSWLHPDSFPILGLPDFRERLPVDGRPLPAPLGGPLSLVEGTGLACDPFGGGGAAG
GGGGLRAFGPAIGGLLAEPAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHR
CADCGKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVC
GAGFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGF
GHSSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRS
VLVTHQRTHTGERPYACANCGRRFSQSSHLLTHMKTHRGATAAPGSGSAPAPAPKPEAAA
KGPSSAGPGERGSALLEFAGGTSFGSEHQAAFAGPSGAYREGVL
Download sequence
Identical sequences A6NFI3
NP_001265488.1.87134 NP_001265488.1.92137 XP_006715693.1.92137 ENSP00000477706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]