SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000478653 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478653
Domain Number 1 Region: 329-403
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000001
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 127-202
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000124
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 964-1053
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000259
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 4 Region: 883-954
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000011
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSP00000478653
Domain Number - Region: 442-494
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000981
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 810-868
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00294
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 215-299
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00353
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 
Domain Number - Region: 51-115
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478653   Gene: ENSG00000185164   Transcript: ENST00000622306
Sequence length 1222
Comment pep:known chromosome:GRCh38:16:18499925:18562112:-1 gene:ENSG00000185164 transcript:ENST00000622306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVGQGAGLLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCNVSPVPGFQPQDESLVYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIVATGFSVCGRISIIRFP
DTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLK
PQTFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSME
AVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTA
YSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKA
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKH
ITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQA
ASDNSGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences NP_775885.1.87134 NP_775885.1.92137 gi|27734709|ref|NP_775885.1| ENSP00000331851 ENSP00000331851 ENSP00000478653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]