SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000478823 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478823
Domain Number 1 Region: 61-250
Classification Level Classification E-value
Superfamily Rhomboid-like 7.46e-20
Family Rhomboid-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478823   Gene: ENSG00000005486   Transcript: ENST00000614848
Sequence length 434
Comment pep:known chromosome:GRCh38:7:75878948:75888920:1 gene:ENSG00000005486 transcript:ENST00000614848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGLWEAWPPAGSSAVAKGNCREEAEGAEDRQPASRRGAGTTAAMAASGPGCRSWCLCP
EVPSATFFTALLSLLVSGPRLFLLQQPLAPSGLTLKSEALRNWQVYRLVTYIFVYENPIS
LLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAVSSLSKLGEVEDARGF
TPVAFAMLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQTSFLSNVCGLSIGLA
YPHLLLFHRPLRASGTEARSDLPLQPDEEDIRVQVRLRVFSREEGSPEPETEPGAWLLPH
TELPPSPVPKPPCVPDAARQWSEAGLLASCTPGHMPTLPPYQPASGLCYVQNHFGPNPTS
SSVYPASAGTSLGIQPPTPVNSPGTVYSGALGHQGLQAPRSPPGSPCPERISREVISLGL
LKVLPKSLLTKVTY
Download sequence
Identical sequences ENSP00000478823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]