SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000478901 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478901
Domain Number 1 Region: 444-505
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000212
Family LIM domain 0.0028
Further Details:      
 
Domain Number 2 Region: 502-572
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000389
Family LIM domain 0.0025
Further Details:      
 
Domain Number 3 Region: 416-442
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000186
Family LIM domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478901   Gene: ENSG00000145012   Transcript: ENST00000617246
Sequence length 612
Comment pep:known chromosome:GRCh38:3:188225405:188890671:1 gene:ENSG00000145012 transcript:ENST00000617246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQ
PGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAE
IDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTL
KPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPSS
GQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGY
YAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPV
SAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCS
KPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCK
EPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSAR
IRVLTAKASTDL
Download sequence
Identical sequences G3RKK7 K7AYG5 Q93052
ENSGGOP00000016276 NP_001161143.1.87134 NP_001161143.1.92137 NP_005569.1.87134 NP_005569.1.92137 XP_005247503.1.92137 XP_005247507.1.92137 XP_005247508.1.92137 XP_005247510.1.92137 XP_011511122.1.92137 XP_011511129.1.92137 XP_011511130.1.92137 XP_011511133.1.92137 XP_011511135.1.92137 XP_011511136.1.92137 XP_016861866.1.92137 XP_016861867.1.92137 XP_016861868.1.92137 XP_016861869.1.92137 XP_018879493.1.27298 gi|264681524|ref|NP_001161143.1| gi|5031887|ref|NP_005569.1| ENSP00000404679 ENSP00000318089 ENSP00000438891 ENSP00000478901 ENSP00000482472 ENSGGOP00000016276 9606.ENSP00000318089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]