SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000478915 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478915
Domain Number 1 Region: 63-232
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.73e-22
Family The homologous-pairing domain of Rad52 recombinase 0.031
Further Details:      
 
Domain Number 2 Region: 11-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000337
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478915   Gene: ENSG00000278023   Transcript: ENST00000616596
Sequence length 251
Comment pep:known chromosome:GRCh38:17:35918066:35930727:-1 gene:ENSG00000278023 transcript:ENST00000616596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPG
FYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANY
YFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLV
EEPMDKVEEESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSL
EEEEFRLPELD
Download sequence
Identical sequences gi|253314445|ref|NP_001156593.1| NP_001156593.1.87134 NP_001156593.1.92137 ENSP00000478915 ENSP00000483566 ENSP00000391290 ENSP00000474637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]